PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G054900.1.p
Common NameGLYMA_06G054900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 105aa    MW: 11911.1 Da    PI: 10.0261
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G054900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK41.82.1e-13146550
               RWP-RK  5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50
                         ++l+dls  F+ ++k+A   L++++Tv+K iCR+y +  WP+R+++
  Glyma.06G054900.1.p  1 MTLNDLSGVFHITMKAAKDVLEMSVTVIKAICRKYRLYKWPQRQLQ 46
                         6899****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151912.787168IPR003035RWP-RK domain
PfamPF020422.6E-13146IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MTLNDLSGVF HITMKAAKDV LEMSVTVIKA ICRKYRLYKW PQRQLQPLAR RLKVLKRALE  60
SSQDPVIIQT TNMEVRRIKQ EMTQLCGGVT PTGIEIPEVE ENSV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0R0JIS02e-72A0A0R0JIS0_SOYBN; Uncharacterized protein
STRINGGLYMA06G05761.12e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Representative plantOGRP1033348